Recombinant Human Putative BCoR-like protein 2 (BCORP1)
This Recombinant Human Putative BCoR-like protein 2 (BCORP1) spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
BCL-6 corepressor pseudogene 1; BCL-6 corepressor-like protein 2
UniProt
Q8N888
Expression Region
1-145aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKEKLSKKRAEVKGNRSWLEEFLKPSDNEEGPPPKNKVLSNNASSQKPTHSSCIPLLRLPDKQQKVNESIKTDMLCTDKEEECPAASLLQKYTNNSEKPSGKRQCKTKHLISQDLRQGFLLTGKCYVENADGKIPLGTCFLLGLI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15171171 1 Vial
Lentiviral mouse Apeh shRNA (UAS) - Lentiviral mouse Apeh shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
201-12-1582 96 Tests
Human Hepatitis D virus IgG (HDV IgG) ELISA Kit
Sign In for Pricing
View Details