Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2), partial

This Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2), partial spans the amino acid sequence from region 207-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM26B

UniProt

Q9HA72

Expression Region

207-323aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fc Fragment of IgG Binding Protein (FcgammaBP) Human ELISA Kit
D3834 96 Tests

Fc Fragment of IgG Binding Protein (FcgammaBP) Human ELISA Kit

Sign In for Pricing
View Details
Box of 100 Mce Membranes 8µm, 50 Mm
MF050ME800C Box of 100

Box of 100 Mce Membranes 8µm, 50 Mm

Sign In for Pricing
View Details
Biotin anti-human CD90 (Thy1)
GT10444 100 µg

Biotin anti-human CD90 (Thy1)

Sign In for Pricing
View Details
Rat Acadm Pre-designed siRNA Set A
SI200118A 1 Each

Rat Acadm Pre-designed siRNA Set A

Sign In for Pricing
View Details
C12orf5 ORF Vector (Human) (pORF)
13761011 1.0 µg DNA

C12orf5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin B1 Antibody (V92.1) [Janelia Fluor 549]
NB100-2648JF549 0.1 mL

Mouse Monoclonal Cyclin B1 Antibody (V92.1) [Janelia Fluor 549]

Sign In for Pricing
View Details