Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathelicidin antimicrobial peptide (Camp)

This Recombinant Mouse Cathelicidin antimicrobial peptide (Camp) spans the amino acid sequence from region 135-172aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathelin-like protein; CLP; Cramp

UniProt

P51437

Expression Region

135-172aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPA4 Rabbit Polyclonal Antibody
MBS9515272-01 0.05 mL

LIPA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIPA4 Rabbit Polyclonal Antibody
MBS9515272-02 0.1 mL

LIPA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIPA4 Rabbit Polyclonal Antibody
MBS9515272-03 5x 0.1 mL

LIPA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS525023 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Human Pyruvate Kinase, Liver And RBC (PK) ELISA Kit
RDR-PK-Hu-01 96 Tests

Human Pyruvate Kinase, Liver And RBC (PK) ELISA Kit

Sign In for Pricing
View Details
Human Pyruvate Kinase, Liver And RBC (PK) ELISA Kit
RDR-PK-Hu-02 48 Tests

Human Pyruvate Kinase, Liver And RBC (PK) ELISA Kit

Sign In for Pricing
View Details