Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G1/S-specific cyclin-D2 (CCND2), Biotinylated

This Recombinant Human G1/S-specific cyclin-D2 (CCND2), Biotinylated spans the amino acid sequence from region 1-289aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P30279

Expression Region

1-289aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

80.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED17
CSB-CL865147HU 10 μg Plasmid + 200 μL Glycerol

MED17

Sign In for Pricing
View Details
Angiotensin II type 1A receptor Rabbit Polyclonal Antibody (RBITC)
orb1050359 100 µL

Angiotensin II type 1A receptor Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Gm5741 ORF Vector (Mouse) (pORF)
ORF046118 1.0 µg DNA

Gm5741 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis UPF0301 protein IL2218 (IL2218)
MBS1330424-01 0.02 mg (E-Coli)

Recombinant Idiomarina loihiensis UPF0301 protein IL2218 (IL2218)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis UPF0301 protein IL2218 (IL2218)
MBS1330424-02 0.1 mg (E-Coli)

Recombinant Idiomarina loihiensis UPF0301 protein IL2218 (IL2218)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis UPF0301 protein IL2218 (IL2218)
MBS1330424-03 0.02 mg (Yeast)

Recombinant Idiomarina loihiensis UPF0301 protein IL2218 (IL2218)

Sign In for Pricing
View Details