Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE), partial

This Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE), partial spans the amino acid sequence from region 21-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q04844

Expression Region

21-239aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Dihydropyrimidinase Like Protein 2 ELISA kit
GTR10398094 96 Well

Human Dihydropyrimidinase Like Protein 2 ELISA kit

Sign In for Pricing
View Details
NAA15 Blocking Peptide
MBS823890-01 1 mg

NAA15 Blocking Peptide

Sign In for Pricing
View Details
NAA15 Blocking Peptide
MBS823890-02 5 mg

NAA15 Blocking Peptide

Sign In for Pricing
View Details
NAA15 Blocking Peptide
MBS823890-03 5x 5 mg

NAA15 Blocking Peptide

Sign In for Pricing
View Details
Serum Amyloid A Antibody
orb2719873 100 µL

Serum Amyloid A Antibody

Sign In for Pricing
View Details
FabF Polyclonal Antibody, FITC Conjugated
A64504-100 100 µL

FabF Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details