Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 1,25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial (Cyp24a1)

This Recombinant Mouse 1,25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial (Cyp24a1) spans the amino acid sequence from region 36-514aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome P450 24A1; Cytochrome P450-CC24;24-OHase; Vitamin D

UniProt

Q64441

Expression Region

36-514aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELPIAFCPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NGF/bNGF Antibody (Tanezumab)
F1513-1 1 mg

Anti-NGF/bNGF Antibody (Tanezumab)

Sign In for Pricing
View Details
4-Fluorothiophenol 99%
F04620 10 g

4-Fluorothiophenol 99%

Sign In for Pricing
View Details
Isopentyl Pentyl Phthalate
TRC-I821930-50MG 50 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Human PRTFDC1 protein
orb756158-01 50 µg

Human PRTFDC1 protein

Sign In for Pricing
View Details
Human PRTFDC1 protein
orb756158-02 100 µg

Human PRTFDC1 protein

Sign In for Pricing
View Details
Human PRTFDC1 protein
orb756158-03 200 µg

Human PRTFDC1 protein

Sign In for Pricing
View Details