Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 15 (GDF15), partial

This Recombinant Human Growth/differentiation factor 15 (GDF15), partial spans the amino acid sequence from region 197-308aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-15; Macrophage inhibitory cytokine 1; MIC-1; NSAID-activated gene 1 protein; NAG-1; NSAID-regulated gene 1 protein; NRG-1; Placental TGF-beta; Placental bone morphogenetic protein; Prostate differentiation factor

UniProt

Q99988

Expression Region

197-308aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mammaglobin B/SCGB2A1 HEK293 Overexpression Lysate
MBS8115490-01 0.3 mg

Human Mammaglobin B/SCGB2A1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human Mammaglobin B/SCGB2A1 HEK293 Overexpression Lysate
MBS8115490-02 5x 0.3 mg

Human Mammaglobin B/SCGB2A1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
AGTR2 Rabbit Monoclonal Antibody
E49Y5718 100 µL

AGTR2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Thielavin A
TRC-T345095-25MG 25 mg

Thielavin A

Sign In for Pricing
View Details
NT5C ORF Vector (Human) (pORF)
32217012 1.0 µg DNA

NT5C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RANBP6 (NM_012416) Human Recombinant Protein
TP310538M 100 µg

RANBP6 (NM_012416) Human Recombinant Protein

Sign In for Pricing
View Details