Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutathione S-transferase theta-1 (GSTT1)

This Recombinant Human Glutathione S-transferase theta-1 (GSTT1) spans the amino acid sequence from region 2-240aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-theta-1; Glutathione transferase T1-1

UniProt

P30711

Expression Region

2-240aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Saclofen
TRC-S080850-50MG 50 mg

Saclofen

Sign In for Pricing
View Details
SCP1 (SYCP1) Human Gene Knockout Kit (CRISPR)
KN424808 1 Kit

SCP1 (SYCP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SCARF2 activation kit by CRISPRa
GA114093 1 Kit

Human SCARF2 activation kit by CRISPRa

Sign In for Pricing
View Details
p-Nitrophenylthiol Acetate
TRC-N505900-1G 1 g

p-Nitrophenylthiol Acetate

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) (NM_000178) Human Over-expression Lysate
LY424876 100 µg

Glutathione Synthetase (GSS) (NM_000178) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCL23 Recombinant Rabbit Monoclonal Antibody [PSH09-05] - BSA and Azide free (Capture)
HA723061 100 µL

Human CCL23 Recombinant Rabbit Monoclonal Antibody [PSH09-05] - BSA and Azide free (Capture)

Sign In for Pricing
View Details