Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Orexin receptor type 2 (HCRTR2), partial

This Recombinant Human Orexin receptor type 2 (HCRTR2), partial spans the amino acid sequence from region 1-54aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ox-2-R; Ox2-R; Ox2R; Hypocretin receptor type 2

UniProt

O43614

Expression Region

1-54aa

Tag

C-terminal hFc1-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECE1 (NM_001113349) Human Recombinant Protein
PH33467M5 20 µg

ECE1 (NM_001113349) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Chml shRNA (UAS) - Lentiviral mouse Chml shRNA (UAS, GFP) (100)
GTR15182553 1 Vial

Lentiviral mouse Chml shRNA (UAS) - Lentiviral mouse Chml shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
C1ORF116 (Specifically Androgen-Regulated Gene Protein, Chromosome 1 Open Reading Frame 116)
476665 100 µL

C1ORF116 (Specifically Androgen-Regulated Gene Protein, Chromosome 1 Open Reading Frame 116)

Sign In for Pricing
View Details
Fto Antibody - N-terminal region : HRP (ARP47473_P050-HRP)
ARP47473_P050-HRP 100 µL

Fto Antibody - N-terminal region : HRP (ARP47473_P050-HRP)

Sign In for Pricing
View Details
PHF16, CT (PHF16, JADE3, KIAA0215, Protein Jade-3, PHD finger protein 16)
MBS6010624-01 0.2 mL

PHF16, CT (PHF16, JADE3, KIAA0215, Protein Jade-3, PHD finger protein 16)

Sign In for Pricing
View Details
PHF16, CT (PHF16, JADE3, KIAA0215, Protein Jade-3, PHD finger protein 16)
MBS6010624-02 5x 0.2 mL

PHF16, CT (PHF16, JADE3, KIAA0215, Protein Jade-3, PHD finger protein 16)

Sign In for Pricing
View Details