Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heterogeneous nuclear ribonucleoprotein D0 (HNRNPD)

This Recombinant Human Heterogeneous nuclear ribonucleoprotein D0 (HNRNPD) spans the amino acid sequence from region 2-355aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HnRNP D0; AU-rich element RNA-binding protein 1

UniProt

Q14103

Expression Region

2-355aa

Tag

N-terminal GST-tagged and C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16-Dehydropregnolone
412058-01 100 mg

16-Dehydropregnolone

Sign In for Pricing
View Details
16-Dehydropregnolone
412058-02 500 mg

16-Dehydropregnolone

Sign In for Pricing
View Details
Rat Monoclonal Caspase-2 Antibody (11B4) [Biotin]
NBP2-80096B 0.1 mL

Rat Monoclonal Caspase-2 Antibody (11B4) [Biotin]

Sign In for Pricing
View Details
pGL4.12[luc2CP] Plasmid
PVTY00791 2 µg

pGL4.12[luc2CP] Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal AFAP1L2 Antibody [DyLight 594]
NBP1-77358DL594 0.1 mL

Rabbit Polyclonal AFAP1L2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Rabbit Anti-G protein alpha 13 antibody
SL13247R-01 50 µL

Rabbit Anti-G protein alpha 13 antibody

Sign In for Pricing
View Details