Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-10 (IL10)

This Recombinant Human Interleukin-10 (IL10) spans the amino acid sequence from region 19-178aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-10; Cytokine synthesis inhibitory factor; CSIF

UniProt

P22301

Expression Region

19-178aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSI 7411 Ammonium Salt
TRC-P839595-25MG 25 mg

PSI 7411 Ammonium Salt

Sign In for Pricing
View Details
Recombinant S100 alpha6 Antibody
RC-6908-01 50 μL

Recombinant S100 alpha6 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha6 Antibody
RC-6908-02 100 µL

Recombinant S100 alpha6 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha6 Antibody
RC-6908-03 1 mL

Recombinant S100 alpha6 Antibody

Sign In for Pricing
View Details
PIGT Human Gene Knockout Kit (CRISPR)
KN401926 1 Kit

PIGT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559778 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details