Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-10 (IL10)

This Recombinant Human Interleukin-10 (IL10) spans the amino acid sequence from region 19-178aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-10; Cytokine synthesis inhibitory factor; CSIF

UniProt

P22301

Expression Region

19-178aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRM1 Human Gene Knockout Kit (CRISPR)
KN400726 1 Kit

RRM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fluorescent NADP/NADPH Detection Kit
NADPH100-3 500 Tests

Fluorescent NADP/NADPH Detection Kit

Sign In for Pricing
View Details
1-Hydroxy-2-naphthoic Acid
TRC-H950850-5G 5 g

1-Hydroxy-2-naphthoic Acid

Sign In for Pricing
View Details
beta Defensin 3 (DEFB103A) (6-22) Mouse Monoclonal Antibody [Clone ID: L3-18b-E1]
AM02222PU-S 10 µg

beta Defensin 3 (DEFB103A) (6-22) Mouse Monoclonal Antibody [Clone ID: L3-18b-E1]

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) Human Gene Knockout Kit (CRISPR)
KN202082LP 1 Kit

alpha 1 Antitrypsin (SERPINA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HELT (NM_001029887) Human Over-expression Lysate
LY422265 100 µg

HELT (NM_001029887) Human Over-expression Lysate

Sign In for Pricing
View Details