Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 8 (MSTN)

This Recombinant Human Growth/differentiation factor 8 (MSTN) spans the amino acid sequence from region 267-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-8; Myostatin

UniProt

O14793

Expression Region

267-375aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G8]
TA501870BM 100 µL

ALDH1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G8]

Sign In for Pricing
View Details
Rabbit Monoclonal STAT3 [p Tyr705] Antibody (1004G) [Janelia Fluor 669]
FAB46071JF669 0.1 mL

Rabbit Monoclonal STAT3 [p Tyr705] Antibody (1004G) [Janelia Fluor 669]

Sign In for Pricing
View Details
IRS-1 Antibody (Phospho-Ser639) : Biotin (OAAF07730-Biotin)
OAAF07730-100UG-Biotin 100 µg

IRS-1 Antibody (Phospho-Ser639) : Biotin (OAAF07730-Biotin)

Sign In for Pricing
View Details
FITC anti-human CD22
E16FHF0221-100 100 Tests

FITC anti-human CD22

Sign In for Pricing
View Details
OKAG02080-2X96W - Phospho-VASP (Ser238) Colorimetric Cell-Based ELISA Kit
OKAG02080-2X96W 2x 96 Well Plates

OKAG02080-2X96W - Phospho-VASP (Ser238) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Human Gap Junction Alpha-8 Protein / CX50 (GJA8) ELISA Kit
abx509390 96 Tests

Human Gap Junction Alpha-8 Protein / CX50 (GJA8) ELISA Kit

Sign In for Pricing
View Details