Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphylocoagulase, partial

This Recombinant Staphylococcus aureus Staphylocoagulase, partial spans the amino acid sequence from region 27-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P07767

Expression Region

27-305aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVTKDYSKESRVNEKSKKGATVSDYYYWKIIDSLEAQFTGAIDLLENYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKWYKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLKQFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVEETKKAVKEADESWKNKTVKKYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIA antibody (HRP)
60R-2221 0.1 mg

PPIA antibody (HRP)

Sign In for Pricing
View Details
HighQCTM Fischer 344 Rat Mesenchymal Stem Cells
ABC-SC051G 1 Vial

HighQCTM Fischer 344 Rat Mesenchymal Stem Cells

Sign In for Pricing
View Details
3-Formylthiophene-2-boronic Acid Pinacol Ester
425866-01 100 mg

3-Formylthiophene-2-boronic Acid Pinacol Ester

Sign In for Pricing
View Details
3-Formylthiophene-2-boronic Acid Pinacol Ester
425866-02 250 mg

3-Formylthiophene-2-boronic Acid Pinacol Ester

Sign In for Pricing
View Details
PKC theta polyclonal antibody
orb1725020-01 50 µL

PKC theta polyclonal antibody

Sign In for Pricing
View Details
PKC theta polyclonal antibody
orb1725020-02 100 µL

PKC theta polyclonal antibody

Sign In for Pricing
View Details