Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C11orf86 homolog

This Recombinant Mouse Uncharacterized protein C11orf86 homolog spans the amino acid sequence from region 1-124aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8VC23

Expression Region

1-124aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGTSLRSQSFREPRPSYGRLHESQGRSLDGRLHRALSLRLGREKSRSQVPDGTEGLEVSVQERLPGTLGDKEQLIQGQRGGGSRRWLRQYQQHVKRRWRSFVASFPSVTLSQPASPETLLDTNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-1-(3-Chloroallyl)-3,5,7-triaza-1-azoniaadamantantane Chloride
TRC-C364230-1G 1 g

cis-1-(3-Chloroallyl)-3,5,7-triaza-1-azoniaadamantantane Chloride

Sign In for Pricing
View Details
CD97 (ADGRE5) (NM_078481) Human Recombinant Protein
TP311647M 100 µg

CD97 (ADGRE5) (NM_078481) Human Recombinant Protein

Sign In for Pricing
View Details
c Kit (KIT) Mouse Monoclonal Antibody [Clone ID: B-K15]
AM31242PU-N 2 mL (200 Tests)

c Kit (KIT) Mouse Monoclonal Antibody [Clone ID: B-K15]

Sign In for Pricing
View Details
Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit
E-EL-H0075-01 24 Tests

Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit

Sign In for Pricing
View Details
Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit
E-EL-H0075-02 48 Tests

Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit

Sign In for Pricing
View Details
Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit
E-EL-H0075-03 96 Tests

Human Flt3L (FMS-like Tyrosine Kinase 3 Ligand) ELISA Kit

Sign In for Pricing
View Details