Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C11orf86 homolog

This Recombinant Mouse Uncharacterized protein C11orf86 homolog spans the amino acid sequence from region 1-124aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8VC23

Expression Region

1-124aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGTSLRSQSFREPRPSYGRLHESQGRSLDGRLHRALSLRLGREKSRSQVPDGTEGLEVSVQERLPGTLGDKEQLIQGQRGGGSRRWLRQYQQHVKRRWRSFVASFPSVTLSQPASPETLLDTNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Explorer™ Live Cell Labeling Kit *Blue Fluorescence*
22606-AAT 200 Tests

Cell Explorer™ Live Cell Labeling Kit *Blue Fluorescence*

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF640R conjugate, 0.1mg/mL
BNC401687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CCNL2 activation kit by CRISPRa
GA113106 1 Kit

Human CCNL2 activation kit by CRISPRa

Sign In for Pricing
View Details
LMOD1 Antibody
KC-574-01 50 μL

LMOD1 Antibody

Sign In for Pricing
View Details
LMOD1 Antibody
KC-574-02 100 µL

LMOD1 Antibody

Sign In for Pricing
View Details
LMOD1 Antibody
KC-574-03 1 mL

LMOD1 Antibody

Sign In for Pricing
View Details