Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human [Pyruvate dehydrogenase (acetyl-transferring) ] kinase isozyme 1, mitochondrial (PDK1)

This Recombinant Human [Pyruvate dehydrogenase (acetyl-transferring) ] kinase isozyme 1, mitochondrial (PDK1) spans the amino acid sequence from region 29-436aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetyl-transferring; Pyruvate dehydrogenase kinase isoform 1; PDH kinase 1

UniProt

Q15118

Expression Region

29-436aa

Tag

C-terminal Flag-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolin (364-5), CF740 conjugate, 0.1mg/mL
BNC740527-500 1x 500 µL

Nucleolin (364-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF405S conjugate, 0.1mg/mL
BNC042391-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2030R), CF647 conjugate, 0.1mg/mL
BNC472030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (TGFA/1119), CF568 conjugate, 0.1mg/mL
BNC681119-500 1x 500 µL

TGFalpha (TGFA/1119), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF647 conjugate, 0.1mg/mL
BNC470812-100 1x 100 µL

Tyrosinase (OCA1/812), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC942562-100 1x 100 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details