Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human [Pyruvate dehydrogenase (acetyl-transferring) ] kinase isozyme 1, mitochondrial (PDK1)

This Recombinant Human [Pyruvate dehydrogenase (acetyl-transferring) ] kinase isozyme 1, mitochondrial (PDK1) spans the amino acid sequence from region 29-436aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetyl-transferring; Pyruvate dehydrogenase kinase isoform 1; PDH kinase 1

UniProt

Q15118

Expression Region

29-436aa

Tag

C-terminal Flag-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIN siRNA Oligos set (Human)
31834171 3x 5 nmol

NIN siRNA Oligos set (Human)

Sign In for Pricing
View Details
SCAFB Antibody
C46165-01 50 µL

SCAFB Antibody

Sign In for Pricing
View Details
SCAFB Antibody
C46165-02 100 µL

SCAFB Antibody

Sign In for Pricing
View Details
RHOC-set siRNA/shRNA/RNAi Lentivector (Human)
39515091 4x 500 ng

RHOC-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Eukaryotic translation initiation Factor 3 subunit J (EIF3J) Rat ELISA Kit
D2806 96 Tests

Eukaryotic translation initiation Factor 3 subunit J (EIF3J) Rat ELISA Kit

Sign In for Pricing
View Details
Human hsa-miR-522-3p miRNA Antagomir
abx885545-01 10 nmol

Human hsa-miR-522-3p miRNA Antagomir

Sign In for Pricing
View Details