Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)

This Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR) spans the amino acid sequence from region 1-175aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UPRTase

UniProt

A6QG99

Expression Region

1-175aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Newman)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQRIPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILLNARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-13 Reference Antibody (anrukinzumab)
M00077-4 100 µg

Anti-IL-13 Reference Antibody (anrukinzumab)

Sign In for Pricing
View Details
RPC62 (POLR3C) (NM_006468) Human 3' UTR Clone
SC200957 10 µg

RPC62 (POLR3C) (NM_006468) Human 3' UTR Clone

Sign In for Pricing
View Details
LOC689959 (NM_001109559) Rat Untagged Clone
RN208378 10 µg

LOC689959 (NM_001109559) Rat Untagged Clone

Sign In for Pricing
View Details
SBDS (5N11) Rabbit Monoclonal Antibody
AMRe17619-01 50 µL

SBDS (5N11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SBDS (5N11) Rabbit Monoclonal Antibody
AMRe17619-02 100 µL

SBDS (5N11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SBDS (5N11) Rabbit Monoclonal Antibody
AMRe17619-03 200 µL

SBDS (5N11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details