Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

This Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial spans the amino acid sequence from region 23-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9WUP1

Expression Region

23-117aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR84 Antibody (Center) Blocking Peptide
MBS9222536-01 0.5 mg

GPR84 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
GPR84 Antibody (Center) Blocking Peptide
MBS9222536-02 5x 0.5 mg

GPR84 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
SPON2 Antibody
orb684491 100 µL

SPON2 Antibody

Sign In for Pricing
View Details
Neuronal Pentraxin 2/NPTX2 Polyclonal Antibody (Capture/Detector)
AN000850P-01 25 µg

Neuronal Pentraxin 2/NPTX2 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details
Neuronal Pentraxin 2/NPTX2 Polyclonal Antibody (Capture/Detector)
AN000850P-02 100 µg

Neuronal Pentraxin 2/NPTX2 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details
Neuronal Pentraxin 2/NPTX2 Polyclonal Antibody (Capture/Detector)
AN000850P-03 1 mg

Neuronal Pentraxin 2/NPTX2 Polyclonal Antibody (Capture/Detector)

Sign In for Pricing
View Details