Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

This Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial spans the amino acid sequence from region 23-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9WUP1

Expression Region

23-117aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF34 sgRNA CRISPR Lentivector (Human) (Target 3)
K2682904 1.0 µg DNA

ZNF34 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
IRF5 (NM_002200) Human Over-expression Lysate
LC419472 20 µg

IRF5 (NM_002200) Human Over-expression Lysate

Sign In for Pricing
View Details
GAST ELISA Kit (Rat) (OKCD07224)
OKCD07224 96 Well

GAST ELISA Kit (Rat) (OKCD07224)

Sign In for Pricing
View Details
BUB1 Antibody
E51A09284 100 µL

BUB1 Antibody

Sign In for Pricing
View Details
Bovine RIMS-Binding Protein 3A (RIMBP3) ELISA Kit
MBS9394935-01 48 Well

Bovine RIMS-Binding Protein 3A (RIMBP3) ELISA Kit

Sign In for Pricing
View Details
Bovine RIMS-Binding Protein 3A (RIMBP3) ELISA Kit
MBS9394935-02 96 Well

Bovine RIMS-Binding Protein 3A (RIMBP3) ELISA Kit

Sign In for Pricing
View Details