Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Large ribosomal subunit protein bL12 (rplL)

This Recombinant Escherichia coli Large ribosomal subunit protein bL12 (rplL) spans the amino acid sequence from region 1-121aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

B1IUR1

Expression Region

1-121aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR562410 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
5-Hydroxy Omeprazole Sodium Salt
TRC-H948863-2.5MG 2.5 mg

5-Hydroxy Omeprazole Sodium Salt

Sign In for Pricing
View Details
Mouse Plek activation kit by CRISPRa
GA205852 1 Kit

Mouse Plek activation kit by CRISPRa

Sign In for Pricing
View Details
Human FNIP1 activation kit by CRISPRa
GA114346 1 Kit

Human FNIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SLCO5A1 Antibody
RC-5092-01 50 μL

Recombinant SLCO5A1 Antibody

Sign In for Pricing
View Details
Recombinant SLCO5A1 Antibody
RC-5092-02 100 µL

Recombinant SLCO5A1 Antibody

Sign In for Pricing
View Details