Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Micrococcus luteus Large ribosomal subunit protein bL12 (rplL)

This Recombinant Micrococcus luteus Large ribosomal subunit protein bL12 (rplL) spans the amino acid sequence from region 1-129aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

C5CC72

Expression Region

1-129aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKLTTEELLAAFEELTLIELSEFIKAFEEKFDVTAAAPVAVAAAGGAAGGAEAAAAEEKDEFDVILEAAGDKKIGVIKEVRALTSLGLKEAKDLVDGAPKPILEGVNKETAEKAKEQLEGAGATVTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mal-β-CD
orb1706283 500 mg

Mal-β-CD

Sign In for Pricing
View Details
Lentiviral mouse Flot1 shRNA (UAS) - Lentiviral mouse Flot1 shRNA (UAS, iRFP) (100)
GTR15118959 1 Vial

Lentiviral mouse Flot1 shRNA (UAS) - Lentiviral mouse Flot1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Caspr2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11129R-BF647 100 µL

Caspr2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Anti-MDM2 antibody
MBS177078-01 0.01 mg

Anti-MDM2 antibody

Sign In for Pricing
View Details
Anti-MDM2 antibody
MBS177078-02 0.1 mg (Carrier Free)

Anti-MDM2 antibody

Sign In for Pricing
View Details
Anti-MDM2 antibody
MBS177078-03 0.1 mg

Anti-MDM2 antibody

Sign In for Pricing
View Details