Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Small ribosomal subunit protein bS16 (rpsP)

This Recombinant Staphylococcus aureus Small ribosomal subunit protein bS16 (rpsP) spans the amino acid sequence from region 1-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q2FHK0

Expression Region

1-91aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain USA300)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4,6-Trifluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenol
PC1027018-01 100 mg

2,4,6-Trifluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenol

Sign In for Pricing
View Details
2,4,6-Trifluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenol
PC1027018-02 250 mg

2,4,6-Trifluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenol

Sign In for Pricing
View Details
2,4,6-Trifluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenol
PC1027018-03 1 g

2,4,6-Trifluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenol

Sign In for Pricing
View Details
ANAPC4 Protein Vector (Human) (pPM-N-D-C-His)
PV321701 500 ng

ANAPC4 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Anti-Laminin-2 LG5 [C3_Hu10]
orb1821531 0.2 mg

Anti-Laminin-2 LG5 [C3_Hu10]

Sign In for Pricing
View Details
START domain containing 7 (STARD7) (NM_020151) Human Tagged ORF Clone Lentiviral Particle
RC202539L3V 200 µL

START domain containing 7 (STARD7) (NM_020151) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details