Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 22 member 4 (SLC22A4), partial

This Recombinant Human Solute carrier family 22 member 4 (SLC22A4), partial spans the amino acid sequence from region 42-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ergothioneine transporter; ET transporter; Organic cation/carnitine transporter 1

UniProt

Q9H015

Expression Region

42-141aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®503R Maleimide
#96079 1x 1 µmol

CF®503R Maleimide

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562819 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
4-Guanidinobenzoic Acid Hydrochloride Salt
TRC-G821300-50G 50 g

4-Guanidinobenzoic Acid Hydrochloride Salt

Sign In for Pricing
View Details
Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)
PKSH032845-01 10 µg

Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)
PKSH032845-02 50 µg

Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)

Sign In for Pricing
View Details
BATF3 Human Gene Knockout Kit (CRISPR)
KN415000 1 Kit

BATF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details