Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Organic cation/carnitine transporter 2 (SLC22A5), partial

This Recombinant Human Organic cation/carnitine transporter 2 (SLC22A5), partial spans the amino acid sequence from region 42-142aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

High-affinity sodium-dependent carnitine cotransporter; Organic cation/carnitine transporter 2

UniProt

O76082

Expression Region

42-142aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ubiquitin Carboxyl-Terminal Hydrolase 46 (USP46) Protein
abx693633 100 µg

Human Ubiquitin Carboxyl-Terminal Hydrolase 46 (USP46) Protein

Sign In for Pricing
View Details
BLOC1S2, Human
Z05082-500 500 µg

BLOC1S2, Human

Sign In for Pricing
View Details
Rabbit Exportin 1 ELISA Kit
MBS084083 Inquire

Rabbit Exportin 1 ELISA Kit

Sign In for Pricing
View Details
TMCO6 Protein Vector (Mouse) (pPB-N-His)
PV238851 500 ng

TMCO6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
EPS8L2 Polyclonal Antibody
A67958-050 50 µL

EPS8L2 Polyclonal Antibody

Sign In for Pricing
View Details
PHLA1 Conjugated Antibody
C34294 100 µL

PHLA1 Conjugated Antibody

Sign In for Pricing
View Details