Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium/manganese antiporter SLC30A10 (SLC30A10), partial

This Recombinant Human Calcium/manganese antiporter SLC30A10 (SLC30A10), partial spans the amino acid sequence from region 135-244aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ZnT-10; Manganese transporter SLC30A10; Solute carrier family 30 member 10

UniProt

Q6XR72

Expression Region

135-244aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVLLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp639 (NM_144519) Mouse Tagged Lenti ORF Clone
MR207772L4 10 µg

Zfp639 (NM_144519) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Evi2a siRNA Oligos set (Mouse)
19542174 3x 5 nmol

Evi2a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
CEMP1 siRNA (Human)
CRJ8761-01 15 nmol

CEMP1 siRNA (Human)

Sign In for Pricing
View Details
CEMP1 siRNA (Human)
CRJ8761-02 30 nmol

CEMP1 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral human PCDHB11 shRNA (UAS) - Lentiviral human PCDHB11 shRNA (UAS, GFP) plasmid
GTR15317113 1 Vial

Lentiviral human PCDHB11 shRNA (UAS) - Lentiviral human PCDHB11 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Clic1 3'UTR Luciferase Stable Cell Line
TU104018 1.0 mL

Clic1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details