Recombinant Rat Sodium-dependent phosphate transport protein 2B (Slc34a2), partial
This Recombinant Rat Sodium-dependent phosphate transport protein 2B (Slc34a2), partial spans the amino acid sequence from region 235-363aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sodium-phosphate transport protein 2B; Sodium/phosphate cotransporter 2B; Solute carrier family 34 member 2; rNaPi IIb
UniProt
Q9JJ09
Expression Region
235-363aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Signal Transduction
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EAATHYLEKLTNLVLETFSFQNGEDAPDILKVITDPFTKLIIQLDKKVIQQIAMGDSEAQNKSLIKIWCKTISNVIEENVTVPSPDNCTSPSYCWTDGIQTWTIQNVTEKENIAKCQHIFVNFSLPDLA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1659502 1.0 µg DNA
PLA2G4D sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
