Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease inhibitor Kazal-type 9 (SPINK9)

This Recombinant Human Serine protease inhibitor Kazal-type 9 (SPINK9) spans the amino acid sequence from region 20-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphoepithelial Kazal-type-related inhibitor 2

UniProt

Q5DT21

Expression Region

20-86aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal MTH1 Antibody (S06-8A6)
NBP3-20081-50ul 50 µL

Rabbit Monoclonal MTH1 Antibody (S06-8A6)

Sign In for Pricing
View Details
Porcine 11-DH-TXB2 ELISA Kit
EF016542 96 Tests

Porcine 11-DH-TXB2 ELISA Kit

Sign In for Pricing
View Details
TRAPPC6A Protein Vector (Rat) (pPB-N-His)
PV312755 500 ng

TRAPPC6A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-SHP2/PTPN11 Antibody Picoband® Fluoro647 Conjugated
PA1860-Fluoro647 100 µg/Vial

Anti-SHP2/PTPN11 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
GJB5 Human shRNA Plasmid Kit (Locus ID 2709)
TR312764 1 Kit

GJB5 Human shRNA Plasmid Kit (Locus ID 2709)

Sign In for Pricing
View Details
Rabbit Polyclonal GPR19 Antibody [mFluor Violet 610 SE]
NBP3-06027MFV610 0.1 mL

Rabbit Polyclonal GPR19 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details