Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAP; TGF-beta-1

UniProt

P04202

Expression Region

279-390aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD39L4 (F-4) : m-IgG Fc BP-HRP Bundle
sc-538030 1 Kit

CD39L4 (F-4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
USP28 Double Nickase Plasmid (h)
sc-407678-NIC 20 µg

USP28 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Vat1l (NM_173016) Mouse Recombinant Protein
PM46530M5 20 µg

Vat1l (NM_173016) Mouse Recombinant Protein

Sign In for Pricing
View Details
Furanodienone
BA3103-10 10 mg

Furanodienone

Sign In for Pricing
View Details
H3FA (HIST1H3A) Rabbit Polyclonal Antibody
TA347195 50 µg

H3FA (HIST1H3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNX33, CT (SNX33, SH3PX3, SH3PXD3C, SNX30, Sorting nexin-33, SH3 and PX domain-containing protein 3) (AP) discontinued
042125-AP 200 µL

SNX33, CT (SNX33, SH3PX3, SH3PXD3C, SNX30, Sorting nexin-33, SH3 and PX domain-containing protein 3) (AP) discontinued

Sign In for Pricing
View Details