Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAP; TGF-beta-1

UniProt

P04202

Expression Region

279-390aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrphostin 23 (RG-50810)
MBS565641-01 10 mg

Tyrphostin 23 (RG-50810)

Sign In for Pricing
View Details
Tyrphostin 23 (RG-50810)
MBS565641-02 5x 10 mg

Tyrphostin 23 (RG-50810)

Sign In for Pricing
View Details
Anti-Caspase 3/CASP3 Antibody Picoband® Fluoro647 Conjugated
PA1849-Fluoro647 100 µg/Vial

Anti-Caspase 3/CASP3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
BLVRB Antibody (FITC)
orb686626-01 50 μL

BLVRB Antibody (FITC)

Sign In for Pricing
View Details
BLVRB Antibody (FITC)
orb686626-02 100 µL

BLVRB Antibody (FITC)

Sign In for Pricing
View Details
β II Tubulin rabbit pAb
ES20591-01 50 µL

β II Tubulin rabbit pAb

Sign In for Pricing
View Details