Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial

This Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial spans the amino acid sequence from region 22-145aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLP-1 receptor; GLP-1-R; GLP-1R

UniProt

O35659

Expression Region

22-145aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF850 3'UTR Luciferase Stable Cell Line
TU029504 1.0 mL

ZNF850 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TAS1R1 Rabbit Polyclonal Antibody
TA337910 100 µL

TAS1R1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mrpl10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
30437114 3x 1.0 µg

Mrpl10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 Protein (C-Flag)
ARP4737-01 10 µg

Recombinant Human PD-L1/B7-H1/CD274 Protein (C-Flag)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 Protein (C-Flag)
ARP4737-02 50 µg

Recombinant Human PD-L1/B7-H1/CD274 Protein (C-Flag)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 Protein (C-Flag)
ARP4737-03 100 µg

Recombinant Human PD-L1/B7-H1/CD274 Protein (C-Flag)

Sign In for Pricing
View Details