Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Glucagon-like peptide 1 receptor (GLP1R), partial

This Recombinant Macaca fascicularis Glucagon-like peptide 1 receptor (GLP1R), partial spans the amino acid sequence from region 24-144aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

F8V479

Expression Region

24-144aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lamtor2 (NM_001106441) Rat Tagged Lenti ORF Clone
RR211360L3 10 µg

Lamtor2 (NM_001106441) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
L-690330 hydrate
orb1689211 100 mg

L-690330 hydrate

Sign In for Pricing
View Details
Recombinant Escherichia coli ATP synthase protein I (atpI), partial
MBS7062384 Inquire

Recombinant Escherichia coli ATP synthase protein I (atpI), partial

Sign In for Pricing
View Details
Human Homeobox Protein CDX-4 (CDX4) ELISA Kit
abx386449 96 Tests

Human Homeobox Protein CDX-4 (CDX4) ELISA Kit

Sign In for Pricing
View Details
Human ASAH1 Pre-designed siRNA Set A
SI001112A 1 Each

Human ASAH1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
AP2M1 (NM_004068) Human Over-expression Lysate
LS001173 100 µg

AP2M1 (NM_004068) Human Over-expression Lysate

Sign In for Pricing
View Details