Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial

This Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial spans the amino acid sequence from region 19-134aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GIP-R; Glucose-dependent insulinotropic polypeptide receptor

UniProt

Q0P543

Expression Region

19-134aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine V-Type Proton ATPase Catalytic Subunit A (ATP6V1A) ELISA Kit-Sandwich
EK12F629-01 48 Test

Porcine V-Type Proton ATPase Catalytic Subunit A (ATP6V1A) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine V-Type Proton ATPase Catalytic Subunit A (ATP6V1A) ELISA Kit-Sandwich
EK12F629-02 96 Tests

Porcine V-Type Proton ATPase Catalytic Subunit A (ATP6V1A) ELISA Kit-Sandwich

Sign In for Pricing
View Details
EPB41L1 (NM_177996) Human Recombinant Protein
TP302596M 100 µg

EPB41L1 (NM_177996) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal SFRS9 Antibody
NBP2-93933-0.1mL 0.1 mL

Rabbit Polyclonal SFRS9 Antibody

Sign In for Pricing
View Details
GENLISA™ Human Lysophosphatidic Acid Receptor 3 (LPAR3) ELISA
KBH21469 1x 96 Well

GENLISA™ Human Lysophosphatidic Acid Receptor 3 (LPAR3) ELISA

Sign In for Pricing
View Details
Lentiviral mouse Guca1a shRNA (UAS) - Lentiviral mouseGuca1a shRNA (UAS, GFP) (25)
GTR15163436 1 Vial

Lentiviral mouse Guca1a shRNA (UAS) - Lentiviral mouseGuca1a shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details