Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1 (ARG1)

This Recombinant Human Arginase-1 (ARG1) spans the amino acid sequence from region 1-322aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Liver-type arginase; Type I arginase

UniProt

P05089

Expression Region

1-322aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad3 Antibody (Center)
orb1926501-01 50 µL

Smad3 Antibody (Center)

Sign In for Pricing
View Details
Smad3 Antibody (Center)
orb1926501-02 100 µL

Smad3 Antibody (Center)

Sign In for Pricing
View Details
Slc2a2 Rabbit Polyclonal Antibody
TA396527S 25 µL

Slc2a2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTCO2P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV734507 1.0 µg DNA

MTCO2P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PRDM12 Antibody - middle region
OASG06058-100UL 100 µL

PRDM12 Antibody - middle region

Sign In for Pricing
View Details
Recombinant Salmonella fliU Protein (aa 1-169)
VAng-Wyb1088-1mgEcoli 1 mg (E. coli)

Recombinant Salmonella fliU Protein (aa 1-169)

Sign In for Pricing
View Details