Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 type B (CYB5B), partial

This Recombinant Human Cytochrome b5 type B (CYB5B), partial spans the amino acid sequence from region 16-122aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b5 outer mitochondrial membrane isoform

UniProt

O43169

Expression Region

16-122aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1301 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV630651 1.0 µg DNA

Olr1301 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat eIF4E Ready-To-Use IHC Kit
orb3001731 50 Tests

Rat eIF4E Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Beclin-1(Phospho-Ser93) Rabbit Polyclonal Antibody
JOT-AP06338-01 20 µL

Beclin-1(Phospho-Ser93) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beclin-1(Phospho-Ser93) Rabbit Polyclonal Antibody
JOT-AP06338-02 50 μL

Beclin-1(Phospho-Ser93) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beclin-1(Phospho-Ser93) Rabbit Polyclonal Antibody
JOT-AP06338-03 100 µL

Beclin-1(Phospho-Ser93) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chicken Dedicator of Cytokinesis Protein 5 (DOCK5) ELISA Kit
MBS9394017 Inquire

Chicken Dedicator of Cytokinesis Protein 5 (DOCK5) ELISA Kit

Sign In for Pricing
View Details