Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 type B (CYB5B), partial

This Recombinant Human Cytochrome b5 type B (CYB5B), partial spans the amino acid sequence from region 16-122aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b5 outer mitochondrial membrane isoform

UniProt

O43169

Expression Region

16-122aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XIAP/BIRC4
E8ER1918-75 100 µL

XIAP/BIRC4

Sign In for Pricing
View Details
HDBP2 Rabbit Polyclonal Antibody (PE)
orb484345 100 µL

HDBP2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Adam7 (NM_007402) Mouse Tagged Lenti ORF Clone
MR223413L4 10 µg

Adam7 (NM_007402) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human MYEF2 sgRNA gene knockout kit - Lentiviral human MYEF2 sgRNA gene knockout kit (plasmid)
GTR15390665 1 Vial

Lentiviral human MYEF2 sgRNA gene knockout kit - Lentiviral human MYEF2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Galactosyl transferase CpsE (cpsE)
orb2914182-01 20 µg

Recombinant Galactosyl transferase CpsE (cpsE)

Sign In for Pricing
View Details
Recombinant Galactosyl transferase CpsE (cpsE)
orb2914182-02 100 µg

Recombinant Galactosyl transferase CpsE (cpsE)

Sign In for Pricing
View Details