Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial

This Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial spans the amino acid sequence from region 22-118aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SKR3; Activin receptor-like kinase 1; ALK-1; TGF-B superfamily receptor type I; TSR-I

UniProt

P37023

Expression Region

22-118aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRBV26 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV788464 1.0 µg DNA

TRBV26 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TRNAP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV753228 1.0 µg DNA

TRNAP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
LOC441476 Protein Lysate (Human) with C-Ha Tag
27201031 100 µg

LOC441476 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
ABR Rabbit Polyclonal Antibody (Cy3)
orb2617821 100 µg

ABR Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
(R) -Indoxacarb
463981-01 2.5 mg

(R) -Indoxacarb

Sign In for Pricing
View Details
(R) -Indoxacarb
463981-02 25 mg

(R) -Indoxacarb

Sign In for Pricing
View Details