Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

This Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial spans the amino acid sequence from region 22-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-lymphocyte differentiation antigen T8/Leu-2; CD antigen CD8a

UniProt

P01732

Expression Region

22-182aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP4F33P Protein Vector (Human) (pPM-C-HA)
PV072055 500 ng

CYP4F33P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EMP2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2402003 100 µL

EMP2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials
MBS2088430-01 5x 96 Tests

Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials
MBS2088430-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials
MBS2088430-03 10x 96 Tests

Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials
MBS2088430-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

Canine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit DIY Materials

Sign In for Pricing
View Details