Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15)

This Recombinant Human Interleukin-15 (IL15), partial spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-15

UniProt

P40933

Expression Region

49-162aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pparg Mouse Gene Knockout Kit (CRISPR)
KN313675BN 1 Kit

Pparg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNE3 (NM_005472) Human Over-expression Lysate
LY401689 100 µg

KCNE3 (NM_005472) Human Over-expression Lysate

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF647 conjugate, 0.1mg/mL
BNC472868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human ANGPTL7 Protein (His Tag)
PKSH033766-01 10 µg

Recombinant Human ANGPTL7 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL7 Protein (His Tag)
PKSH033766-02 50 µg

Recombinant Human ANGPTL7 Protein (His Tag)

Sign In for Pricing
View Details
CYLD (NM_015247) Human Recombinant Protein
TP319629M 100 µg

CYLD (NM_015247) Human Recombinant Protein

Sign In for Pricing
View Details