Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15)

This Recombinant Human Interleukin-15 (IL15), partial spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-15

UniProt

P40933

Expression Region

49-162aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myt1l (NM_001093776) Mouse Tagged ORF Clone
MG223831 10 µg

Myt1l (NM_001093776) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Monoclonal CD79A Antibody (clone HM57), Clone: HM57
AMM01939G 0.05mg

Monoclonal CD79A Antibody (clone HM57), Clone: HM57

Sign In for Pricing
View Details
8-amino-6-tert-butyl[1,2,4]triazolo[4,3-b][1,2,4]triazin-7 (8H) -one
sc-351585A 1 g

8-amino-6-tert-butyl[1,2,4]triazolo[4,3-b][1,2,4]triazin-7 (8H) -one

Sign In for Pricing
View Details
Bocanta
orb1698055 25 mg

Bocanta

Sign In for Pricing
View Details
TCF7L2 Protein Lysate (Human) with C-Ha Tag
46388031 100 µg

TCF7L2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Endothelin B Receptor (EDNRB) Rabbit Polyclonal Antibody
TA371110 100 µL

Endothelin B Receptor (EDNRB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details