Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-13 (IL13)

This Recombinant Dog Interleukin-13 (IL13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13

UniProt

Q9N0W9

Expression Region

19-131aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB4 Human Gene Knockout Kit (CRISPR)
KN401574 1 Kit

NDUFB4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wilms Tumor Protein (WT1) (NM_001198552) Human Over-expression Lysate
LY434129 100 µg

Wilms Tumor Protein (WT1) (NM_001198552) Human Over-expression Lysate

Sign In for Pricing
View Details
ADB-5'Br-BINACA
TRC-A433420-500MG 500 mg

ADB-5'Br-BINACA

Sign In for Pricing
View Details
Usp51 Mouse Gene Knockout Kit (CRISPR)
KN518810 1 Kit

Usp51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
AP06535PU-N 100 µg

MEK1 (MAP2K1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGEF7 Polyclonal Antibody
E-AB-14609-01 20 µL

ARHGEF7 Polyclonal Antibody

Sign In for Pricing
View Details