Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-13 (IL13)

This Recombinant Dog Interleukin-13 (IL13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13

UniProt

Q9N0W9

Expression Region

19-131aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC5 pSer498 Rabbit Polyclonal Antibody
AP02465PU-N 100 µL

HDAC5 pSer498 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]
TA501183AM 100 µL

ERCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]

Sign In for Pricing
View Details
KChIP2 (KCNIP2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]
TA807375AM 100 µL

KChIP2 (KCNIP2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]

Sign In for Pricing
View Details
Bacitracin Zinc (>80%)
TRC-B106505-250MG 250 mg

Bacitracin Zinc (>80%)

Sign In for Pricing
View Details
Human SNX22 activation kit by CRISPRa
GA112681 1 Kit

Human SNX22 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505514 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details