Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial

This Recombinant Human Tissue factor (F3), partial spans the amino acid sequence from region 33-251aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TF; Coagulation factor III; Thromboplastin; CD antigen CD142

UniProt

P13726

Expression Region

33-251aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI1E5]
CF809858 100 µg

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI1E5]

Sign In for Pricing
View Details
5- (2- (Benzyloxy) -5-methylphenyl) thiazol-2-amine
OR1089290-01 250 mg

5- (2- (Benzyloxy) -5-methylphenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (2- (Benzyloxy) -5-methylphenyl) thiazol-2-amine
OR1089290-02 500 mg

5- (2- (Benzyloxy) -5-methylphenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (2- (Benzyloxy) -5-methylphenyl) thiazol-2-amine
OR1089290-03 1 g

5- (2- (Benzyloxy) -5-methylphenyl) thiazol-2-amine

Sign In for Pricing
View Details
Breast Hyperplasia (NAT) and Breast Normal Adjacent Tissue TMA, 10 cases/30 cores(1.5mm), replacing BN08111
BN08111a 1 Each

Breast Hyperplasia (NAT) and Breast Normal Adjacent Tissue TMA, 10 cases/30 cores(1.5mm), replacing BN08111

Sign In for Pricing
View Details
Recombinant Cla c 9 (v2)
E4A10Z01-v2 50 µg

Recombinant Cla c 9 (v2)

Sign In for Pricing
View Details