Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial

This Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial spans the amino acid sequence from region 25-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; Lymphocyte-associated receptor of death; LARD; Protein WSL; Protein WSL-1

UniProt

Q93038

Expression Region

25-199aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Variable Volume 8 Channel Micropipette BPIP-309
BPIP-309 1 Unit

Variable Volume 8 Channel Micropipette BPIP-309

Sign In for Pricing
View Details
DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody
HA723250 100 µL

DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
INPP4B Antibody
KC-3122-01 50 μL

INPP4B Antibody

Sign In for Pricing
View Details
INPP4B Antibody
KC-3122-02 100 µL

INPP4B Antibody

Sign In for Pricing
View Details
INPP4B Antibody
KC-3122-03 1 mL

INPP4B Antibody

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), 0.2mg/mL
BNUB0685-500 1x 500 µL

CD68 (C68/684 + KP1), 0.2mg/mL

Sign In for Pricing
View Details