Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-3 (Il3)

This Recombinant Mouse Interleukin-3 (Il3) spans the amino acid sequence from region 27-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

UniProt

P01586

Expression Region

27-166aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKp46 shRNA (h) Lentiviral Particles
sc-42951-V 200 µL

NKp46 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
ZBTB37 Protein Vector (Human) (pPM-C-His)
PV046868 500 ng

ZBTB37 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Olfr926 CRISPR Activation Plasmid (m2)
sc-434922-ACT-2 20 µg

Olfr926 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Lysosomal Galactosidase Staining Kit
G1581 100 Tests

Lysosomal Galactosidase Staining Kit

Sign In for Pricing
View Details
SLC7A3 Antibody
ABD9355 100 µg

SLC7A3 Antibody

Sign In for Pricing
View Details
STARCH AGAR
S19-123-01 500 g

STARCH AGAR

Sign In for Pricing
View Details