Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-17A (IL17A)

This Recombinant Bovine Interleukin-17A (IL17A) spans the amino acid sequence from region 24-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-17; IL-17A

UniProt

Q687Y7

Expression Region

24-153aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Efaprinermin alfa
T82502-01 1 mg

Efaprinermin alfa

Sign In for Pricing
View Details
Efaprinermin alfa
T82502-02 5 mg

Efaprinermin alfa

Sign In for Pricing
View Details
RALB Antibody
OACA08153-50UL 50 µL

RALB Antibody

Sign In for Pricing
View Details
RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued
225529-01 50 µL

RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued

Sign In for Pricing
View Details
RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued
225529-02 100 µL

RFC4 (A1 37, A1 37kD Subunit, Activator 1 37, Activator 1 37kD Subunit, Activator 1 Subunit 4, Replication Factor C 37, Replication Factor C 37kD Subunit, Replication Factor C Subunit 4, Replication Factor C4, RF-C 37kD Subunit, RFC 37, RFC37, RFC4 replication Factor C (Activator 1) 4 37kDa, RfC4, RFC4_HUMAN, ) discontinued

Sign In for Pricing
View Details
Formyl-Histone H2B type 2E (Lys117) Recombinant Antibody, RBITC Conjugated
bsm-62408R-RBITC-01 20 µL

Formyl-Histone H2B type 2E (Lys117) Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details