Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 106B (TMEM106B), partial

This Recombinant Human Transmembrane protein 106B (TMEM106B), partial spans the amino acid sequence from region 120-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9NUM4

Expression Region

120-254aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX3 HDR Plasmid (m)
sc-429851-HDR 20 µg

ACOX3 HDR Plasmid (m)

Sign In for Pricing
View Details
RPL23AP48 CRISPRa sgRNA lentivector (set of three targets)(Human)
41173121 3x 1.0µg DNA

RPL23AP48 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
RAD51AP1 AAV siRNA Pooled Vector
38420161 1.0 µg

RAD51AP1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human PDLIM1 Pre-designed siRNA Set A
SI011924A 1 Each

Human PDLIM1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Anti-VEGFA Antibody (MOFY-0722-FY16)
MOFY-0722-FY16 Each

Mouse Anti-VEGFA Antibody (MOFY-0722-FY16)

Sign In for Pricing
View Details
Camel Acylglycerol Kinase ELISA Kit
MBS070217-01 48 Well

Camel Acylglycerol Kinase ELISA Kit

Sign In for Pricing
View Details