Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Regakine-1

This Recombinant Bovine Regakine-1 spans the amino acid sequence from region 22-92aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P82943

Expression Region

22-92aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEAVIFQTRSGRSICANPGQAWVQKYIEYLDQMSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-5-nitropyridine
TRC-B686260-5G 5 g

2-Bromo-5-nitropyridine

Sign In for Pricing
View Details
T Plastin (PLS3) (NM_001172335) Human Over-expression Lysate
LC433333 20 µg

T Plastin (PLS3) (NM_001172335) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Neuropilin-2/NRP2 Protein (His Tag)
PKSH030458 50 µg

Recombinant Human Neuropilin-2/NRP2 Protein (His Tag)

Sign In for Pricing
View Details
Biotin-11-UTP, 75 mM in pH 7.5 Tris-HCl Buffer
#40071 1x 30 µL

Biotin-11-UTP, 75 mM in pH 7.5 Tris-HCl Buffer

Sign In for Pricing
View Details
Cell Meter™ Fluorimetric Mitochondrial Superoxide Activity Assay Kit*Optimized for Flow Cytometry*
22970-AAT 100 Tests

Cell Meter™ Fluorimetric Mitochondrial Superoxide Activity Assay Kit*Optimized for Flow Cytometry*

Sign In for Pricing
View Details
Bsp19I, 25 preps
FDRE1190 25 Preparations

Bsp19I, 25 preps

Sign In for Pricing
View Details