Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Netrin receptor UNC5C (UNC5C) (A150V), partial

This Recombinant Human Netrin receptor UNC5C (UNC5C) (A150V), partial spans the amino acid sequence from region 61-270aa (A150V) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein unc-5 homolog 3; Protein unc-5 homolog C

UniProt

O95185

Expression Region

61-270aa (A150V)

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Neuroblastoma Antibody (FMG25) [PE/Cy7]
NBP2-50528PECY7 0.1 mL

Mouse Monoclonal Neuroblastoma Antibody (FMG25) [PE/Cy7]

Sign In for Pricing
View Details
Ethyl undecanoate
T84124 10 g

Ethyl undecanoate

Sign In for Pricing
View Details
PRKCH Protein (N-GST, Human)
P527794 100 µg

PRKCH Protein (N-GST, Human)

Sign In for Pricing
View Details
CD59 Reference Antibody
orb1805863-01 100 µg

CD59 Reference Antibody

Sign In for Pricing
View Details
CD59 Reference Antibody
orb1805863-02 1 mg

CD59 Reference Antibody

Sign In for Pricing
View Details
EIF3H Antibody
OACA07767-50UL 50 µL

EIF3H Antibody

Sign In for Pricing
View Details